- Recombinant Helicobacter pylori Putative biopolymer transport protein exbD-like 1 (HP_1129)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1121508
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 15,414 Da
- E Coli or Yeast
- 1-133
- Putative biopolymer transport protein exbD-like 1 (HP_1129)
Sequence
MNYDNYWDEDKPELNITPLVDVMLVLLAILMVTTPTLTYKEEIALPSGSKTARATQDKMIEIRMDKDAKIYIDSQTYEYNSFPDTFNLLSKKYDKDTRVSIRADKRLTYDKVIYLLKTIKEAGFLKVSLITSP